Anti SETD1A pAb (ATL-HPA058376 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA058376-25

• 

Protein Description: SET domain containing 1A
Gene Name: SETD1A
Alternative Gene Name: KIAA0339, KMT2F, Set1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042308: 88%, ENSRNOG00000055028: 89%
Entrez Gene ID: 9739
Uniprot ID: O15047
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SQFRSSDANYPAYYESWNRYQRHTSYPPRRATREEPPGAPFAENTAERFPPSYTSYLPPEPSRPTDQDYRPPASEA
• Gene Sequence: SQFRSSDANYPAYYESWNRYQRHTSYPPRRATREEPPGAPFAENTAERFPPSYTSYLPPEPSRPTDQDYRPPASEA
• Gene ID - Mouse: ENSMUSG00000042308
• Gene ID - Rat: ENSRNOG00000055028
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.