Anti SERPINB4 pAb (ATL-HPA048341)

Atlas Antibodies

SKU: ATL-HPA048341-25

• 

Protein Description: serpin peptidase inhibitor, clade B (ovalbumin), member 4
Gene Name: SERPINB4
Alternative Gene Name: LEUPIN, PI11, SCCA-2, SCCA1, SCCA2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058017: 61%, ENSRNOG00000002578: 61%
Entrez Gene ID: 6318
Uniprot ID: P48594
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QEYLDAIKKFYQTSVESTDFANAPEESRKKI
• Gene Sequence: QEYLDAIKKFYQTSVESTDFANAPEESRKKI
• Gene ID - Mouse: ENSMUSG00000058017
• Gene ID - Rat: ENSRNOG00000002578
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.