Anti SEPT9 pAb (ATL-HPA050627)

Atlas Antibodies

SKU:
ATL-HPA050627-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to actin filaments.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: septin 9
Gene Name: SEPT9
Alternative Gene Name: AF17q25, KIAA0991, MSF, MSF1, PNUTL4, SeptD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059248: 75%, ENSRNOG00000002807: 77%
Entrez Gene ID: 10801
Uniprot ID: Q9UHD8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PAPVSQLQSRLEPKPQPPVAEATPRSQEATEAAPSCVGDMADTPRDAGLKQAPASRNEKAPVDFGYVGIDS
Gene Sequence PAPVSQLQSRLEPKPQPPVAEATPRSQEATEAAPSCVGDMADTPRDAGLKQAPASRNEKAPVDFGYVGIDS
Gene ID - Mouse ENSMUSG00000059248
Gene ID - Rat ENSRNOG00000002807
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SEPT9 pAb (ATL-HPA050627)
Datasheet Anti SEPT9 pAb (ATL-HPA050627) Datasheet (External Link)
Vendor Page Anti SEPT9 pAb (ATL-HPA050627) at Atlas Antibodies

Documents & Links for Anti SEPT9 pAb (ATL-HPA050627)
Datasheet Anti SEPT9 pAb (ATL-HPA050627) Datasheet (External Link)
Vendor Page Anti SEPT9 pAb (ATL-HPA050627)