Protein Description: septin 5
Gene Name: SEPT5
Alternative Gene Name: H5, HCDCREL-1, PNUTL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072214: 97%, ENSRNOG00000029912: 97%
Entrez Gene ID: 5413
Uniprot ID: Q99719
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SEPT5
Alternative Gene Name: H5, HCDCREL-1, PNUTL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072214: 97%, ENSRNOG00000029912: 97%
Entrez Gene ID: 5413
Uniprot ID: Q99719
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | VPLIAKADCLVPSEIRKLKERIREEIDKFGIHVYQFPE |
| Documents & Links for Anti SEPT5 pAb (ATL-HPA063885 w/enhanced validation) | |
| Datasheet | Anti SEPT5 pAb (ATL-HPA063885 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SEPT5 pAb (ATL-HPA063885 w/enhanced validation) at Atlas |
| Documents & Links for Anti SEPT5 pAb (ATL-HPA063885 w/enhanced validation) | |
| Datasheet | Anti SEPT5 pAb (ATL-HPA063885 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SEPT5 pAb (ATL-HPA063885 w/enhanced validation) |