Anti SEPT10 pAb (ATL-HPA047860 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA047860-25
  • Immunofluorescent staining of human cell line A-431 shows localization to actin filaments.
  • Western blot analysis in human cell lines A-431 and MCF-7 using Anti-SEPT10 antibody. Corresponding SEPT10 RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: septin 10
Gene Name: SEPT10
Alternative Gene Name: FLJ11619
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046541: 31%, ENSRNOG00000004696: 31%
Entrez Gene ID: 151011
Uniprot ID: Q9P0V9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MASSEVARHLLFQSHMATKTTCMSSQGSDDEQIKRENIRSLTMSGHVG
Gene Sequence MASSEVARHLLFQSHMATKTTCMSSQGSDDEQIKRENIRSLTMSGHVG
Gene ID - Mouse ENSMUSG00000046541
Gene ID - Rat ENSRNOG00000004696
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti SEPT10 pAb (ATL-HPA047860 w/enhanced validation)
Datasheet Anti SEPT10 pAb (ATL-HPA047860 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SEPT10 pAb (ATL-HPA047860 w/enhanced validation)