Anti SEMA5B pAb (ATL-HPA066548 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA066548-25

• 
• 

Protein Description: sema domain, seven thrombospondin repeats (type 1 and type 1-like), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5B
Gene Name: SEMA5B
Alternative Gene Name: FLJ10372, KIAA1445, SEMAG, SemG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052133: 99%, ENSRNOG00000002238: 90%
Entrez Gene ID: 54437
Uniprot ID: Q9P283
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QESTLVHPATPNHLHYKGGGTPKNEKYTPMEFKTLNKNNLIPDDRANFYPLQQTNVYTTTYYPSPLNKHSFRPEASPGQRCFPN
• Gene Sequence: QESTLVHPATPNHLHYKGGGTPKNEKYTPMEFKTLNKNNLIPDDRANFYPLQQTNVYTTTYYPSPLNKHSFRPEASPGQRCFPN
• Gene ID - Mouse: ENSMUSG00000052133
• Gene ID - Rat: ENSRNOG00000002238
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SEMA5B pAb (ATL-HPA066548 w/enhanced validation) – 1 Found

Kundu, Anirban; Nam, Hyeyoung; Shelar, Sandeep; Chandrashekar, Darshan S; Brinkley, Garrett; Karki, Suman; Mitchell, Tanecia; Livi, Carolina B; Buckhaults, Phillip; Kirkman, Richard; Tang, Yawen; Rowe, Glenn C; Wei, Shi; Varambally, Sooryanarayana; Sudarshan, Sunil. PRDM16 suppresses HIF-targeted gene expression in kidney cancer. The Journal Of Experimental Medicine. 2020;217(6)