Protein Description: sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4F
Gene Name: SEMA4F
Alternative Gene Name: SEMAM, SEMAW
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000627: 91%, ENSRNOG00000006784: 91%
Entrez Gene ID: 10505
Uniprot ID: O95754
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SEMA4F
Alternative Gene Name: SEMAM, SEMAW
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000627: 91%, ENSRNOG00000006784: 91%
Entrez Gene ID: 10505
Uniprot ID: O95754
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | RTSLPISEADSCLTRFAVPHTYNYSVLLVDPASHTLYVGARDTIFALSLPFSGERPRRIDWMVPEAHRQNCRKKGKKEDECHNFVQIL |
Documents & Links for Anti SEMA4F pAb (ATL-HPA065969) | |
Datasheet | Anti SEMA4F pAb (ATL-HPA065969) Datasheet (External Link) |
Vendor Page | Anti SEMA4F pAb (ATL-HPA065969) at Atlas |
Documents & Links for Anti SEMA4F pAb (ATL-HPA065969) | |
Datasheet | Anti SEMA4F pAb (ATL-HPA065969) Datasheet (External Link) |
Vendor Page | Anti SEMA4F pAb (ATL-HPA065969) |