Anti SEMA4A pAb (ATL-HPA069136)

Atlas Antibodies

SKU: ATL-HPA069136-25

• 
• 

Protein Description: sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4A
Gene Name: SEMA4A
Alternative Gene Name: CORD10, FLJ12287, SEMAB, SemB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028064: 86%, ENSRNOG00000019737: 81%
Entrez Gene ID: 64218
Uniprot ID: Q9H3S1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SGVEYTRLAVETAQGLDGHSHLVMYLGTTTGSLHKAVVSGDSSAHLVEEIQLFPDPEPVRNLQLAPTQGAVFVGFSGGVWRVPRANCSVYE
• Gene Sequence: SGVEYTRLAVETAQGLDGHSHLVMYLGTTTGSLHKAVVSGDSSAHLVEEIQLFPDPEPVRNLQLAPTQGAVFVGFSGGVWRVPRANCSVYE
• Gene ID - Mouse: ENSMUSG00000028064
• Gene ID - Rat: ENSRNOG00000019737
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.