Protein Description: SEM1, 26S proteasome complex subunit
Gene Name: SEM1
Alternative Gene Name: DSS1, ECD, SHFD1, Shfdg1, SHFM1, SHSF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042541: 100%, ENSRNOG00000010420: 100%
Entrez Gene ID: 7979
Uniprot ID: P60896
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SEM1
Alternative Gene Name: DSS1, ECD, SHFD1, Shfdg1, SHFM1, SHSF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042541: 100%, ENSRNOG00000010420: 100%
Entrez Gene ID: 7979
Uniprot ID: P60896
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDED |
| Documents & Links for Anti SEM1 pAb (ATL-HPA072648) | |
| Datasheet | Anti SEM1 pAb (ATL-HPA072648) Datasheet (External Link) |
| Vendor Page | Anti SEM1 pAb (ATL-HPA072648) at Atlas |
| Documents & Links for Anti SEM1 pAb (ATL-HPA072648) | |
| Datasheet | Anti SEM1 pAb (ATL-HPA072648) Datasheet (External Link) |
| Vendor Page | Anti SEM1 pAb (ATL-HPA072648) |