Anti SELL pAb (ATL-HPA051972)

Atlas Antibodies

SKU: ATL-HPA051972-25

• 

Protein Description: selectin L
Gene Name: SELL
Alternative Gene Name: CD62L, hLHRc, LAM-1, LAM1, Leu-8, LNHR, LSEL, Lyam-1, LYAM1, PLNHR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026581: 58%, ENSRNOG00000002776: 60%
Entrez Gene ID: 6402
Uniprot ID: P14151
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MGCRRTREGPSKAMIFPWKCQSTQRDLWNIFKLWGWTMLCCDFLAHHGTDCWTYHYSEKPMNWQRARRFCRDNYTD
• Gene Sequence: MGCRRTREGPSKAMIFPWKCQSTQRDLWNIFKLWGWTMLCCDFLAHHGTDCWTYHYSEKPMNWQRARRFCRDNYTD
• Gene ID - Mouse: ENSMUSG00000026581
• Gene ID - Rat: ENSRNOG00000002776
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.