Anti SELENOH pAb (ATL-HPA048362)

Atlas Antibodies

SKU:
ATL-HPA048362-25
  • Immunohistochemical staining of human tonsil shows strong nuclear positivity in non-germinal center cells.
  • Immunofluorescent staining of human cell line MCF7 shows localization to nucleus & nucleoli.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: selenoprotein H
Gene Name: SELENOH
Alternative Gene Name: C11orf31, SELH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000076437: 89%, ENSRNOG00000054563: 87%
Entrez Gene ID:
Uniprot ID: Q8IZQ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KVNPTKPRRGSFEVTLLRPDGSSAELWTGIKKGPPRKLKFPEPQEVVEELKKYLS
Gene Sequence KVNPTKPRRGSFEVTLLRPDGSSAELWTGIKKGPPRKLKFPEPQEVVEELKKYLS
Gene ID - Mouse ENSMUSG00000076437
Gene ID - Rat ENSRNOG00000054563
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SELENOH pAb (ATL-HPA048362)
Datasheet Anti SELENOH pAb (ATL-HPA048362) Datasheet (External Link)
Vendor Page Anti SELENOH pAb (ATL-HPA048362) at Atlas Antibodies

Documents & Links for Anti SELENOH pAb (ATL-HPA048362)
Datasheet Anti SELENOH pAb (ATL-HPA048362) Datasheet (External Link)
Vendor Page Anti SELENOH pAb (ATL-HPA048362)