Anti SEL1L2 pAb (ATL-HPA059121)

Atlas Antibodies

SKU:
ATL-HPA059121-25
  • Immunohistochemical staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: sel-1 suppressor of lin-12-like 2 (C. elegans)
Gene Name: SEL1L2
Alternative Gene Name: C20orf50, DKFZp434C1826
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074764: 94%, ENSRNOG00000004852: 94%
Entrez Gene ID: 80343
Uniprot ID: Q5TEA6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FGSAGGNMMSQMILGYRYLSGINVLQNCEVALSYYKKVADYIADTFEKSEGVPVEKVRLTERPENLSSNSEILDWDIYQYYKFLAERGDVQIQVSL
Gene Sequence FGSAGGNMMSQMILGYRYLSGINVLQNCEVALSYYKKVADYIADTFEKSEGVPVEKVRLTERPENLSSNSEILDWDIYQYYKFLAERGDVQIQVSL
Gene ID - Mouse ENSMUSG00000074764
Gene ID - Rat ENSRNOG00000004852
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SEL1L2 pAb (ATL-HPA059121)
Datasheet Anti SEL1L2 pAb (ATL-HPA059121) Datasheet (External Link)
Vendor Page Anti SEL1L2 pAb (ATL-HPA059121) at Atlas Antibodies

Documents & Links for Anti SEL1L2 pAb (ATL-HPA059121)
Datasheet Anti SEL1L2 pAb (ATL-HPA059121) Datasheet (External Link)
Vendor Page Anti SEL1L2 pAb (ATL-HPA059121)