Anti SEC63 pAb (ATL-HPA053295 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA053295-25

• 
• 
• 

Protein Description: SEC63 homolog (S. cerevisiae)
Gene Name: SEC63
Alternative Gene Name: DNAJC23, ERdj2, PRO2507, SEC63L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019802: 100%, ENSRNOG00000000314: 100%
Entrez Gene ID: 11231
Uniprot ID: Q9UGP8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: REYQEYNPYEVLNLDPGATVAEIKKQYRLLSLKYHPDKGGDEVMFMRIAKAYAALTDEESRKNWEEFGNPDGPQATSFGIALPA
• Gene Sequence: REYQEYNPYEVLNLDPGATVAEIKKQYRLLSLKYHPDKGGDEVMFMRIAKAYAALTDEESRKNWEEFGNPDGPQATSFGIALPA
• Gene ID - Mouse: ENSMUSG00000019802
• Gene ID - Rat: ENSRNOG00000000314
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SEC63 pAb (ATL-HPA053295 w/enhanced validation) – 1 Found

Bergström, Sofia; Öijerstedt, Linn; Remnestål, Julia; Olofsson, Jennie; Ullgren, Abbe; Seelaar, Harro; van Swieten, John C; Synofzik, Matthis; Sanchez-Valle, Raquel; Moreno, Fermin; Finger, Elizabeth; Masellis, Mario; Tartaglia, Carmela; Vandenberghe, Rik; Laforce, Robert; Galimberti, Daniela; Borroni, Barbara; Butler, Chris R; Gerhard, Alexander; Ducharme, Simon; Rohrer, Jonathan D; Månberg, Anna; Graff, Caroline; Nilsson, Peter. A panel of CSF proteins separates genetic frontotemporal dementia from presymptomatic mutation carriers: a GENFI study. Molecular Neurodegeneration. 2021;16(1):79.