Anti SEC61B pAb (ATL-HPA049407)

Atlas Antibodies

SKU:
ATL-HPA049407-25
  • Immunohistochemical staining of human pancreas shows moderate to strong positivity in endoplasmic reticulum in exocrine glandular cells.
  • Immunofluorescent staining of human cell line PC-3 shows localization to endoplasmic reticulum.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: Sec61 beta subunit
Gene Name: SEC61B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053317: 100%, ENSRNOG00000006345: 100%
Entrez Gene ID: 10952
Uniprot ID: P60468
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYTEDSPGLK
Gene Sequence AAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYTEDSPGLK
Gene ID - Mouse ENSMUSG00000053317
Gene ID - Rat ENSRNOG00000006345
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SEC61B pAb (ATL-HPA049407)
Datasheet Anti SEC61B pAb (ATL-HPA049407) Datasheet (External Link)
Vendor Page Anti SEC61B pAb (ATL-HPA049407) at Atlas Antibodies

Documents & Links for Anti SEC61B pAb (ATL-HPA049407)
Datasheet Anti SEC61B pAb (ATL-HPA049407) Datasheet (External Link)
Vendor Page Anti SEC61B pAb (ATL-HPA049407)