Anti SEC31A pAb (ATL-HPA005457)
Atlas Antibodies
- SKU:
- ATL-HPA005457-25
- Shipping:
- Calculated at Checkout
$395.00
Product Description
Protein Description: SEC31 homolog A (S. cerevisiae)
Gene Name: SEC31A
Alternative Gene Name: ABP125, ABP130, KIAA0905, SEC31L1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035325: 93%, ENSRNOG00000002251: 92%
Entrez Gene ID: 22872
Uniprot ID: O94979
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SEC31A
Alternative Gene Name: ABP125, ABP130, KIAA0905, SEC31L1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035325: 93%, ENSRNOG00000002251: 92%
Entrez Gene ID: 22872
Uniprot ID: O94979
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NWREALAAVLTYAKPDEFSALCDLLGTRLENEGDSLLQTQACLCYICAGNVEKLVACWTKAQDGSHPLSLQDLIEKVVILRKAVQLTQAMDTSTVGVLLAAKMSQYANLLAAQGSIAAALAFLPDNTNQPNIMQLR |
Gene Sequence | NWREALAAVLTYAKPDEFSALCDLLGTRLENEGDSLLQTQACLCYICAGNVEKLVACWTKAQDGSHPLSLQDLIEKVVILRKAVQLTQAMDTSTVGVLLAAKMSQYANLLAAQGSIAAALAFLPDNTNQPNIMQLR |
Gene ID - Mouse | ENSMUSG00000035325 |
Gene ID - Rat | ENSRNOG00000002251 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti SEC31A pAb (ATL-HPA005457) | |
Datasheet | Anti SEC31A pAb (ATL-HPA005457) Datasheet (External Link) |
Vendor Page | Anti SEC31A pAb (ATL-HPA005457) at Atlas Antibodies |
Documents & Links for Anti SEC31A pAb (ATL-HPA005457) | |
Datasheet | Anti SEC31A pAb (ATL-HPA005457) Datasheet (External Link) |
Vendor Page | Anti SEC31A pAb (ATL-HPA005457) |
Citations
Citations for Anti SEC31A pAb (ATL-HPA005457) – 4 Found |
Jansen, Jos C; Timal, Sharita; van Scherpenzeel, Monique; Michelakakis, Helen; Vicogne, Dorothée; Ashikov, Angel; Moraitou, Marina; Hoischen, Alexander; Huijben, Karin; Steenbergen, Gerry; van den Boogert, Marjolein A W; Porta, Francesco; Calvo, Pier Luigi; Mavrikou, Mersyni; Cenacchi, Giovanna; van den Bogaart, Geert; Salomon, Jody; Holleboom, Adriaan G; Rodenburg, Richard J; Drenth, Joost P H; Huynen, Martijn A; Wevers, Ron A; Morava, Eva; Foulquier, François; Veltman, Joris A; Lefeber, Dirk J. TMEM199 Deficiency Is a Disorder of Golgi Homeostasis Characterized by Elevated Aminotransferases, Alkaline Phosphatase, and Cholesterol and Abnormal Glycosylation. American Journal Of Human Genetics. 2016;98(2):322-30. PubMed |
Jansen, Jos C; Cirak, Sebahattin; van Scherpenzeel, Monique; Timal, Sharita; Reunert, Janine; Rust, Stephan; Pérez, Belén; Vicogne, Dorothée; Krawitz, Peter; Wada, Yoshinao; Ashikov, Angel; Pérez-Cerdá, Celia; Medrano, Celia; Arnoldy, Andrea; Hoischen, Alexander; Huijben, Karin; Steenbergen, Gerry; Quelhas, Dulce; Diogo, Luisa; Rymen, Daisy; Jaeken, Jaak; Guffon, Nathalie; Cheillan, David; van den Heuvel, Lambertus P; Maeda, Yusuke; Kaiser, Olaf; Schara, Ulrike; Gerner, Patrick; van den Boogert, Marjolein A W; Holleboom, Adriaan G; Nassogne, Marie-Cécile; Sokal, Etienne; Salomon, Jody; van den Bogaart, Geert; Drenth, Joost P H; Huynen, Martijn A; Veltman, Joris A; Wevers, Ron A; Morava, Eva; Matthijs, Gert; Foulquier, François; Marquardt, Thorsten; Lefeber, Dirk J. CCDC115 Deficiency Causes a Disorder of Golgi Homeostasis with Abnormal Protein Glycosylation. American Journal Of Human Genetics. 2016;98(2):310-21. PubMed |
Chierico, Luca; Rizzello, Loris; Guan, Lijuan; Joseph, Adrian Steve; Lewis, Andrew; Battaglia, Giuseppe. The role of the two splice variants and extranuclear pathway on Ki-67 regulation in non-cancer and cancer cells. Plos One. 12(2):e0171815. PubMed |
Zappa, Francesca; Wilson, Cathal; Di Tullio, Giuseppe; Santoro, Michele; Pucci, Piero; Monti, Maria; D'Amico, Davide; Pisonero-Vaquero, Sandra; De Cegli, Rossella; Romano, Alessia; Saleem, Moin A; Polishchuk, Elena; Failli, Mario; Giaquinto, Laura; De Matteis, Maria Antonietta. The TRAPP complex mediates secretion arrest induced by stress granule assembly. The Embo Journal. 2019;38(19):e101704. PubMed |