Anti SEC22C pAb (ATL-HPA055594)

Atlas Antibodies

SKU:
ATL-HPA055594-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to the Golgi apparatus.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: SEC22 homolog C, vesicle trafficking protein
Gene Name: SEC22C
Alternative Gene Name: MGC13261, MGC5373, SEC22L3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061536: 80%, ENSRNOG00000047873: 73%
Entrez Gene ID: 9117
Uniprot ID: Q9BRL7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TASYDTTCIGLASRPYAFLEFDSIIQKVKWHFNYVSSSQMECSLEKIQEELKLQPPAVLTLEDTDVANGVMNGHTPMHL
Gene Sequence TASYDTTCIGLASRPYAFLEFDSIIQKVKWHFNYVSSSQMECSLEKIQEELKLQPPAVLTLEDTDVANGVMNGHTPMHL
Gene ID - Mouse ENSMUSG00000061536
Gene ID - Rat ENSRNOG00000047873
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SEC22C pAb (ATL-HPA055594)
Datasheet Anti SEC22C pAb (ATL-HPA055594) Datasheet (External Link)
Vendor Page Anti SEC22C pAb (ATL-HPA055594) at Atlas Antibodies

Documents & Links for Anti SEC22C pAb (ATL-HPA055594)
Datasheet Anti SEC22C pAb (ATL-HPA055594) Datasheet (External Link)
Vendor Page Anti SEC22C pAb (ATL-HPA055594)