Anti SEC16B pAb (ATL-HPA054292)

Atlas Antibodies

SKU: ATL-HPA054292-25

• 

Protein Description: SEC16 homolog B, endoplasmic reticulum export factor
Gene Name: SEC16B
Alternative Gene Name: LZTR2, PGPR-p117, RGPR, Sec16S
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026589: 62%, ENSRNOG00000005229: 62%
Entrez Gene ID: 89866
Uniprot ID: Q96JE7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SYQSPTMREEYAYGSYYYHGHPQWLQEERVPRQRSPYIWHEDYREQKYLDEHHYENQHSPFGTNSETHFQSNSR
• Gene Sequence: SYQSPTMREEYAYGSYYYHGHPQWLQEERVPRQRSPYIWHEDYREQKYLDEHHYENQHSPFGTNSETHFQSNSR
• Gene ID - Mouse: ENSMUSG00000026589
• Gene ID - Rat: ENSRNOG00000005229
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.