Protein Description: serologically defined colon cancer antigen 8
Gene Name: SDCCAG8
Alternative Gene Name: BBS16, CCCAP, NPHP10, NY-CO-8, SLSN7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026504: 70%, ENSRNOG00000004181: 68%
Entrez Gene ID: 10806
Uniprot ID: Q86SQ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SDCCAG8
Alternative Gene Name: BBS16, CCCAP, NPHP10, NY-CO-8, SLSN7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026504: 70%, ENSRNOG00000004181: 68%
Entrez Gene ID: 10806
Uniprot ID: Q86SQ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | AKSPENSTLEEILGQYQRSLREHASRSIHQLTCALKEGDVTIGEDAPNLSFSTSVGNEDARTAWPELQQSHAVNQLKDLLRQQADKESEV |
| Documents & Links for Anti SDCCAG8 pAb (ATL-HPA072495) | |
| Datasheet | Anti SDCCAG8 pAb (ATL-HPA072495) Datasheet (External Link) |
| Vendor Page | Anti SDCCAG8 pAb (ATL-HPA072495) at Atlas |
| Documents & Links for Anti SDCCAG8 pAb (ATL-HPA072495) | |
| Datasheet | Anti SDCCAG8 pAb (ATL-HPA072495) Datasheet (External Link) |
| Vendor Page | Anti SDCCAG8 pAb (ATL-HPA072495) |