Anti SDC3 pAb (ATL-HPA048085)

Atlas Antibodies

SKU:
ATL-HPA048085-25
  • Immunofluorescent staining of human cell line A-431 shows localization to nuclear speckles & mitochondria.
  • Western blot analysis in human cell line RT-4, human cell line U-251 MG and human plasma.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: syndecan 3
Gene Name: SDC3
Alternative Gene Name: N-syndecan, SYND3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025743: 76%, ENSRNOG00000011927: 78%
Entrez Gene ID: 9672
Uniprot ID: O75056
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GDDDSFPDDELDDLYSGSGSGYFEQESGIETAMRFSPDVALAVSTTPAVLPTTNIQPVGTPFEELPSERPTLEPATSPLVVTEVPEEPSQRATTVSTTMATTA
Gene Sequence GDDDSFPDDELDDLYSGSGSGYFEQESGIETAMRFSPDVALAVSTTPAVLPTTNIQPVGTPFEELPSERPTLEPATSPLVVTEVPEEPSQRATTVSTTMATTA
Gene ID - Mouse ENSMUSG00000025743
Gene ID - Rat ENSRNOG00000011927
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SDC3 pAb (ATL-HPA048085)
Datasheet Anti SDC3 pAb (ATL-HPA048085) Datasheet (External Link)
Vendor Page Anti SDC3 pAb (ATL-HPA048085) at Atlas Antibodies

Documents & Links for Anti SDC3 pAb (ATL-HPA048085)
Datasheet Anti SDC3 pAb (ATL-HPA048085) Datasheet (External Link)
Vendor Page Anti SDC3 pAb (ATL-HPA048085)