Anti SCRT1 pAb (ATL-HPA045265 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA045265-25
  • Immunohistochemistry analysis in human cerebral cortex and skeletal muscle tissues using HPA045265 antibody. Corresponding SCRT1 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line SH-SY5Y shows localization to nuclear bodies.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: scratch family zinc finger 1
Gene Name: SCRT1
Alternative Gene Name: DKFZp547F072, ZNF898
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048385: 96%, ENSRNOG00000025594: 96%
Entrez Gene ID: 83482
Uniprot ID: Q9BWW7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human, Mouse
Clonality Polyclonal
Host Rabbit
Immunogen LHDKGYLSDYVGPSSVYDGDAEAALLKGPSPEPMYAAAVRGELGP
Gene Sequence LHDKGYLSDYVGPSSVYDGDAEAALLKGPSPEPMYAAAVRGELGP
Gene ID - Mouse ENSMUSG00000048385
Gene ID - Rat ENSRNOG00000025594
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SCRT1 pAb (ATL-HPA045265 w/enhanced validation)
Datasheet Anti SCRT1 pAb (ATL-HPA045265 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SCRT1 pAb (ATL-HPA045265 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti SCRT1 pAb (ATL-HPA045265 w/enhanced validation)
Datasheet Anti SCRT1 pAb (ATL-HPA045265 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SCRT1 pAb (ATL-HPA045265 w/enhanced validation)



Citations for Anti SCRT1 pAb (ATL-HPA045265 w/enhanced validation) – 1 Found
Kawaue, T; Shitamukai, A; Nagasaka, A; Tsunekawa, Y; Shinoda, T; Saito, K; Terada, R; Bilgic, M; Miyata, T; Matsuzaki, F; Kawaguchi, A. Lzts1 controls both neuronal delamination and outer radial glial-like cell generation during mammalian cerebral development. Nature Communications. 2019;10(1):2780.  PubMed