Anti SCML4 pAb (ATL-HPA065958)

Atlas Antibodies

SKU: ATL-HPA065958-25

• 
• 

Protein Description: sex comb on midleg-like 4 (Drosophila)
Gene Name: SCML4
Alternative Gene Name: dJ47M23.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044770: 56%, ENSRNOG00000026110: 65%
Entrez Gene ID: 256380
Uniprot ID: Q8N228
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CSASEKVQEKEEGRMESVKTVTTEEYLVNPVGMNRYSVDTSASTFNHRGSLHPSSSLYCKRQNSGD
• Gene Sequence: CSASEKVQEKEEGRMESVKTVTTEEYLVNPVGMNRYSVDTSASTFNHRGSLHPSSSLYCKRQNSGD
• Gene ID - Mouse: ENSMUSG00000044770
• Gene ID - Rat: ENSRNOG00000026110
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.