Anti SCMH1 pAb (ATL-HPA053292)

Atlas Antibodies

SKU: ATL-HPA053292-25

• 

Protein Description: sex comb on midleg homolog 1 (Drosophila)
Gene Name: SCMH1
Alternative Gene Name: Scml3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000085: 87%, ENSRNOG00000032183: 88%
Entrez Gene ID: 22955
Uniprot ID: Q96GD3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SRGVLKGSNERRDMESFWKLNRSPGSDRYLESRDASRLSGRDPSSWTVEDVMQFVREADPQLGPHAD
• Gene Sequence: SRGVLKGSNERRDMESFWKLNRSPGSDRYLESRDASRLSGRDPSSWTVEDVMQFVREADPQLGPHAD
• Gene ID - Mouse: ENSMUSG00000000085
• Gene ID - Rat: ENSRNOG00000032183
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.