Anti SCCPDH pAb (ATL-HPA050775)

Atlas Antibodies

SKU:
ATL-HPA050775-100
  • Immunohistochemical staining of human testis shows cytoplasmic positivity in cells in seminiferous ducts.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
  • Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10<br/>Lane 2: Human cell line RT-4
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: saccharopine dehydrogenase (putative)
Gene Name: SCCPDH
Alternative Gene Name: CGI-49, NET11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038936: 85%, ENSRNOG00000046051: 87%
Entrez Gene ID: 51097
Uniprot ID: Q8NBX0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YGEPVIKACIENGASCIDISGEPQFLELMQLKYHEKAADKGVYIIGSSGFDSIPADLGVIYTRNKMNGTLTAVESFLTIHSGPEGLSIHDGTWKSAIYGFGDQSNLRKLRNVSNLKPVPLIGPKLK
Gene Sequence YGEPVIKACIENGASCIDISGEPQFLELMQLKYHEKAADKGVYIIGSSGFDSIPADLGVIYTRNKMNGTLTAVESFLTIHSGPEGLSIHDGTWKSAIYGFGDQSNLRKLRNVSNLKPVPLIGPKLK
Gene ID - Mouse ENSMUSG00000038936
Gene ID - Rat ENSRNOG00000046051
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SCCPDH pAb (ATL-HPA050775)
Datasheet Anti SCCPDH pAb (ATL-HPA050775) Datasheet (External Link)
Vendor Page Anti SCCPDH pAb (ATL-HPA050775) at Atlas Antibodies

Documents & Links for Anti SCCPDH pAb (ATL-HPA050775)
Datasheet Anti SCCPDH pAb (ATL-HPA050775) Datasheet (External Link)
Vendor Page Anti SCCPDH pAb (ATL-HPA050775)