Anti SCARB1 pAb (ATL-HPA066285)

Atlas Antibodies

SKU:
ATL-HPA066285-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: scavenger receptor class B, member 1
Gene Name: SCARB1
Alternative Gene Name: CD36L1, CLA-1, CLA1, SR-BI, SRB1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037936: 78%, ENSRNOG00000000981: 76%
Entrez Gene ID: 949
Uniprot ID: Q8WTV0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PRSLSFNMWKEIPIPFYLSVYFFDVMNPSEILKGEKPQVRERGPYVYREFRHKSNITFNNNDTVSFLEYRTFQFQPSKSHGSESDYIVMPNILVLGA
Gene Sequence PRSLSFNMWKEIPIPFYLSVYFFDVMNPSEILKGEKPQVRERGPYVYREFRHKSNITFNNNDTVSFLEYRTFQFQPSKSHGSESDYIVMPNILVLGA
Gene ID - Mouse ENSMUSG00000037936
Gene ID - Rat ENSRNOG00000000981
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SCARB1 pAb (ATL-HPA066285)
Datasheet Anti SCARB1 pAb (ATL-HPA066285) Datasheet (External Link)
Vendor Page Anti SCARB1 pAb (ATL-HPA066285) at Atlas Antibodies

Documents & Links for Anti SCARB1 pAb (ATL-HPA066285)
Datasheet Anti SCARB1 pAb (ATL-HPA066285) Datasheet (External Link)
Vendor Page Anti SCARB1 pAb (ATL-HPA066285)