Anti SCAMP5 pAb (ATL-HPA046645 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA046645-100

• 
• 

Protein Description: secretory carrier membrane protein 5
Gene Name: SCAMP5
Alternative Gene Name: MGC24969
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040722: 100%, ENSRNOG00000054008: 100%
Entrez Gene ID: 192683
Uniprot ID: Q8TAC9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GSFSKAQEEWTTGAWKNPHVQQAAQNAAMGAAQGAMNQPQTQYSATPNYTYSNE
• Gene Sequence: GSFSKAQEEWTTGAWKNPHVQQAAQNAAMGAAQGAMNQPQTQYSATPNYTYSNE
• Gene ID - Mouse: ENSMUSG00000040722
• Gene ID - Rat: ENSRNOG00000054008
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.