Protein Description: secretory carrier membrane protein 3
Gene Name: SCAMP3
Alternative Gene Name: C1orf3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028049: 87%, ENSRNOG00000020500: 86%
Entrez Gene ID: 10067
Uniprot ID: O14828
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SCAMP3
Alternative Gene Name: C1orf3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028049: 87%, ENSRNOG00000020500: 86%
Entrez Gene ID: 10067
Uniprot ID: O14828
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MAQSRDGGNPFAEPSELDNPFQDPAVIQHRPSRQYATLDVYNPFETREPPPAYEP |
| Documents & Links for Anti SCAMP3 pAb (ATL-HPA071167) | |
| Datasheet | Anti SCAMP3 pAb (ATL-HPA071167) Datasheet (External Link) |
| Vendor Page | Anti SCAMP3 pAb (ATL-HPA071167) at Atlas |
| Documents & Links for Anti SCAMP3 pAb (ATL-HPA071167) | |
| Datasheet | Anti SCAMP3 pAb (ATL-HPA071167) Datasheet (External Link) |
| Vendor Page | Anti SCAMP3 pAb (ATL-HPA071167) |