Anti SCAF11 pAb (ATL-HPA046345)

Atlas Antibodies

SKU:
ATL-HPA046345-25
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: SR-related CTD-associated factor 11
Gene Name: SCAF11
Alternative Gene Name: CASP11, SFRS2IP, SIP1, SRRP129, SRSF2IP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033228: 86%, ENSRNOG00000005263: 87%
Entrez Gene ID: 9169
Uniprot ID: Q99590
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SFKFVEQQSYKRKSEQEFSFDTPADRSGWTSASSWAVRKTLPADVQNYYSRRGRNSSGPQSGWMKQEEETSGQDSSLKDQTNQ
Gene Sequence SFKFVEQQSYKRKSEQEFSFDTPADRSGWTSASSWAVRKTLPADVQNYYSRRGRNSSGPQSGWMKQEEETSGQDSSLKDQTNQ
Gene ID - Mouse ENSMUSG00000033228
Gene ID - Rat ENSRNOG00000005263
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SCAF11 pAb (ATL-HPA046345)
Datasheet Anti SCAF11 pAb (ATL-HPA046345) Datasheet (External Link)
Vendor Page Anti SCAF11 pAb (ATL-HPA046345) at Atlas Antibodies

Documents & Links for Anti SCAF11 pAb (ATL-HPA046345)
Datasheet Anti SCAF11 pAb (ATL-HPA046345) Datasheet (External Link)
Vendor Page Anti SCAF11 pAb (ATL-HPA046345)