Anti SCAF1 pAb (ATL-HPA046828)

Atlas Antibodies

SKU:
ATL-HPA046828-25
  • Immunohistochemical staining of human stomach, lower shows strong cytiplasmic positivity in glandular cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: SR-related CTD-associated factor 1
Gene Name: SCAF1
Alternative Gene Name: FLJ00034, SR-A1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038406: 91%, ENSRNOG00000056946: 91%
Entrez Gene ID: 58506
Uniprot ID: Q9H7N4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SRKVKLQSKVAVLIREGVSSTTPAKDAASAGLGSIGVKFSRDRESRSPFLKPDERAPTEMAKAAPGSTKPKKTKVKAKAGAKKTKGTKGKTKPSKT
Gene Sequence SRKVKLQSKVAVLIREGVSSTTPAKDAASAGLGSIGVKFSRDRESRSPFLKPDERAPTEMAKAAPGSTKPKKTKVKAKAGAKKTKGTKGKTKPSKT
Gene ID - Mouse ENSMUSG00000038406
Gene ID - Rat ENSRNOG00000056946
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SCAF1 pAb (ATL-HPA046828)
Datasheet Anti SCAF1 pAb (ATL-HPA046828) Datasheet (External Link)
Vendor Page Anti SCAF1 pAb (ATL-HPA046828) at Atlas Antibodies

Documents & Links for Anti SCAF1 pAb (ATL-HPA046828)
Datasheet Anti SCAF1 pAb (ATL-HPA046828) Datasheet (External Link)
Vendor Page Anti SCAF1 pAb (ATL-HPA046828)