Anti SBK3 pAb (ATL-HPA078322)

Atlas Antibodies

SKU: ATL-HPA078322-25

• 

Product Description

Protein Description: SH3 domain binding kinase family member 3
Gene Name: SBK3
Alternative Gene Name: SgK110
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000085272: 85%, ENSRNOG00000042927: 77%
Entrez Gene ID: 100130827
Uniprot ID: P0C264
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EDTATALQRLVELTTSRVTPVRSLRDQYHLIRKLGSGSY
• Gene Sequence: EDTATALQRLVELTTSRVTPVRSLRDQYHLIRKLGSGSY
• Gene ID - Mouse: ENSMUSG00000085272
• Gene ID - Rat: ENSRNOG00000042927
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links