Anti SBK3 pAb (ATL-HPA078322)
Atlas Antibodies
- SKU:
- ATL-HPA078322-25
- Shipping:
- Calculated at Checkout
$303.00
Product Description
Protein Description: SH3 domain binding kinase family member 3
Gene Name: SBK3
Alternative Gene Name: SgK110
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000085272: 85%, ENSRNOG00000042927: 77%
Entrez Gene ID: 100130827
Uniprot ID: P0C264
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SBK3
Alternative Gene Name: SgK110
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000085272: 85%, ENSRNOG00000042927: 77%
Entrez Gene ID: 100130827
Uniprot ID: P0C264
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EDTATALQRLVELTTSRVTPVRSLRDQYHLIRKLGSGSY |
Gene Sequence | EDTATALQRLVELTTSRVTPVRSLRDQYHLIRKLGSGSY |
Gene ID - Mouse | ENSMUSG00000085272 |
Gene ID - Rat | ENSRNOG00000042927 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti SBK3 pAb (ATL-HPA078322) | |
Datasheet | Anti SBK3 pAb (ATL-HPA078322) Datasheet (External Link) |
Vendor Page | Anti SBK3 pAb (ATL-HPA078322) at Atlas Antibodies |
Documents & Links for Anti SBK3 pAb (ATL-HPA078322) | |
Datasheet | Anti SBK3 pAb (ATL-HPA078322) Datasheet (External Link) |
Vendor Page | Anti SBK3 pAb (ATL-HPA078322) |