Anti SBF2 pAb (ATL-HPA050933)

Atlas Antibodies

SKU: ATL-HPA050933-25

• 
• 

Protein Description: SET binding factor 2
Gene Name: SBF2
Alternative Gene Name: CMT4B2, DENND7B, KIAA1766, MTMR13
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038371: 63%, ENSRNOG00000009812: 67%
Entrez Gene ID: 81846
Uniprot ID: Q86WG5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NQAPEKWQQLWERVTVDLKEEPRTDRSQRHLSRSPGIVSTNLPSYQKRSLLHLPDSSMGEEQNSSISPSNGVERR
• Gene Sequence: NQAPEKWQQLWERVTVDLKEEPRTDRSQRHLSRSPGIVSTNLPSYQKRSLLHLPDSSMGEEQNSSISPSNGVERR
• Gene ID - Mouse: ENSMUSG00000038371
• Gene ID - Rat: ENSRNOG00000009812
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.