Anti SATL1 pAb (ATL-HPA060369)

Atlas Antibodies

SKU:
ATL-HPA060369-25
  • Immunohistochemical staining of human bone marrow shows strong cytoplasmic positivity in subset of hematopoietic cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: spermidine/spermine N1-acetyl transferase-like 1
Gene Name: SATL1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022983: 47%, ENSRNOG00000002104: 49%
Entrez Gene ID: 340562
Uniprot ID: Q86VE3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GTWQTGLSQPVPRQPNKSPPGMWQRGMWQPGMSQQVPSQLGMRQPGTSQSSKNQTGMSHPGRGQPGIWEP
Gene Sequence GTWQTGLSQPVPRQPNKSPPGMWQRGMWQPGMSQQVPSQLGMRQPGTSQSSKNQTGMSHPGRGQPGIWEP
Gene ID - Mouse ENSMUSG00000022983
Gene ID - Rat ENSRNOG00000002104
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SATL1 pAb (ATL-HPA060369)
Datasheet Anti SATL1 pAb (ATL-HPA060369) Datasheet (External Link)
Vendor Page Anti SATL1 pAb (ATL-HPA060369) at Atlas Antibodies

Documents & Links for Anti SATL1 pAb (ATL-HPA060369)
Datasheet Anti SATL1 pAb (ATL-HPA060369) Datasheet (External Link)
Vendor Page Anti SATL1 pAb (ATL-HPA060369)