Anti SATB1 pAb (ATL-HPA051769)

Atlas Antibodies

SKU:
ATL-HPA051769-25
  • Immunohistochemical staining of human thymus shows strong nuclear positivity in cortical cells.
  • Immunofluorescent staining of human cell line HEK 293 shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: SATB homeobox 1
Gene Name: SATB1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023927: 92%, ENSRNOG00000012942: 92%
Entrez Gene ID: 6304
Uniprot ID: Q01826
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ENLSMIRRFLSLPQPERDAIYEQESNAVHHHGDRPPHIIHVPAEQIQSPSPTTLGKGESRGVFLPGLPTPAPWLGAAPQ
Gene Sequence ENLSMIRRFLSLPQPERDAIYEQESNAVHHHGDRPPHIIHVPAEQIQSPSPTTLGKGESRGVFLPGLPTPAPWLGAAPQ
Gene ID - Mouse ENSMUSG00000023927
Gene ID - Rat ENSRNOG00000012942
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SATB1 pAb (ATL-HPA051769)
Datasheet Anti SATB1 pAb (ATL-HPA051769) Datasheet (External Link)
Vendor Page Anti SATB1 pAb (ATL-HPA051769) at Atlas Antibodies

Documents & Links for Anti SATB1 pAb (ATL-HPA051769)
Datasheet Anti SATB1 pAb (ATL-HPA051769) Datasheet (External Link)
Vendor Page Anti SATB1 pAb (ATL-HPA051769)