Anti SARS2 pAb (ATL-HPA052730)

Atlas Antibodies

SKU:
ATL-HPA052730-25
  • Immunohistochemical staining of human kidney shows strong cytoplasmic positivity with a granular pattern in tubular cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: seryl-tRNA synthetase 2, mitochondrial
Gene Name: SARS2
Alternative Gene Name: FLJ20450, mtSerRS, SARS, SARSM, SerRSmt, SERS, SYS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070699: 91%, ENSRNOG00000019962: 89%
Entrez Gene ID: 54938
Uniprot ID: Q9NP81
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QIYNIDPARFKDLNLAGTAEVGLAGYFMDHTVAFRDLPVRMVCSSTCYRAETNTGQEPRGLYRVHHFTKVEMFGVTGPGL
Gene Sequence QIYNIDPARFKDLNLAGTAEVGLAGYFMDHTVAFRDLPVRMVCSSTCYRAETNTGQEPRGLYRVHHFTKVEMFGVTGPGL
Gene ID - Mouse ENSMUSG00000070699
Gene ID - Rat ENSRNOG00000019962
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SARS2 pAb (ATL-HPA052730)
Datasheet Anti SARS2 pAb (ATL-HPA052730) Datasheet (External Link)
Vendor Page Anti SARS2 pAb (ATL-HPA052730) at Atlas Antibodies

Documents & Links for Anti SARS2 pAb (ATL-HPA052730)
Datasheet Anti SARS2 pAb (ATL-HPA052730) Datasheet (External Link)
Vendor Page Anti SARS2 pAb (ATL-HPA052730)