Protein Description: seryl-tRNA synthetase
Gene Name: SARS
Alternative Gene Name: SERS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068739: 99%, ENSRNOG00000020255: 97%
Entrez Gene ID: 6301
Uniprot ID: P49591
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SARS
Alternative Gene Name: SERS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068739: 99%, ENSRNOG00000020255: 97%
Entrez Gene ID: 6301
Uniprot ID: P49591
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | GSRGYIPIYTPFFMRKEVMQEVAQLSQFDEELYKVIGKGSEKSDDNSYDEKYLIATSEQPIAALHRDEWLRPEDLPIKYAGLSTCFRQ |
| Documents & Links for Anti SARS pAb (ATL-HPA064668) | |
| Datasheet | Anti SARS pAb (ATL-HPA064668) Datasheet (External Link) |
| Vendor Page | Anti SARS pAb (ATL-HPA064668) at Atlas |
| Documents & Links for Anti SARS pAb (ATL-HPA064668) | |
| Datasheet | Anti SARS pAb (ATL-HPA064668) Datasheet (External Link) |
| Vendor Page | Anti SARS pAb (ATL-HPA064668) |