Anti SARDH pAb (ATL-HPA058086)

Atlas Antibodies

SKU:
ATL-HPA058086-25
  • Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: sarcosine dehydrogenase
Gene Name: SARDH
Alternative Gene Name: DMGDHL1, SDH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000009614: 91%, ENSRNOG00000006916: 92%
Entrez Gene ID: 1757
Uniprot ID: Q9UL12
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EETGLHTGWIQNGGLFIASNRQRLDEYKRLMSLGKAYGVESHVLSPAETKTLYPLMNVDDLYGTLYVPHDGTMDPAGTCTTLARAASARGAQVIENCPVTGIRVWTDDFGVRRVAGVETQHGSI
Gene Sequence EETGLHTGWIQNGGLFIASNRQRLDEYKRLMSLGKAYGVESHVLSPAETKTLYPLMNVDDLYGTLYVPHDGTMDPAGTCTTLARAASARGAQVIENCPVTGIRVWTDDFGVRRVAGVETQHGSI
Gene ID - Mouse ENSMUSG00000009614
Gene ID - Rat ENSRNOG00000006916
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SARDH pAb (ATL-HPA058086)
Datasheet Anti SARDH pAb (ATL-HPA058086) Datasheet (External Link)
Vendor Page Anti SARDH pAb (ATL-HPA058086) at Atlas Antibodies

Documents & Links for Anti SARDH pAb (ATL-HPA058086)
Datasheet Anti SARDH pAb (ATL-HPA058086) Datasheet (External Link)
Vendor Page Anti SARDH pAb (ATL-HPA058086)