Anti SAR1B pAb (ATL-HPA048368)

Atlas Antibodies

SKU: ATL-HPA048368-100

• 
• 

Protein Description: secretion associated, Ras related GTPase 1B
Gene Name: SAR1B
Alternative Gene Name: SARA2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020386: 100%, ENSRNOG00000004820: 99%
Entrez Gene ID: 51128
Uniprot ID: Q9Y6B6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TLLHMLKDDRLGQHVPTLHPTSEELTIAGMTFTTFDLGGHVQARRVWKNYLPAINGIVFLVDCADHE
• Gene Sequence: TLLHMLKDDRLGQHVPTLHPTSEELTIAGMTFTTFDLGGHVQARRVWKNYLPAINGIVFLVDCADHE
• Gene ID - Mouse: ENSMUSG00000020386
• Gene ID - Rat: ENSRNOG00000004820
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.