Anti SAR1B pAb (ATL-HPA048368)
Atlas Antibodies
- SKU:
- ATL-HPA048368-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: SAR1B
Alternative Gene Name: SARA2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020386: 100%, ENSRNOG00000004820: 99%
Entrez Gene ID: 51128
Uniprot ID: Q9Y6B6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TLLHMLKDDRLGQHVPTLHPTSEELTIAGMTFTTFDLGGHVQARRVWKNYLPAINGIVFLVDCADHE |
Gene Sequence | TLLHMLKDDRLGQHVPTLHPTSEELTIAGMTFTTFDLGGHVQARRVWKNYLPAINGIVFLVDCADHE |
Gene ID - Mouse | ENSMUSG00000020386 |
Gene ID - Rat | ENSRNOG00000004820 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SAR1B pAb (ATL-HPA048368) | |
Datasheet | Anti SAR1B pAb (ATL-HPA048368) Datasheet (External Link) |
Vendor Page | Anti SAR1B pAb (ATL-HPA048368) at Atlas Antibodies |
Documents & Links for Anti SAR1B pAb (ATL-HPA048368) | |
Datasheet | Anti SAR1B pAb (ATL-HPA048368) Datasheet (External Link) |
Vendor Page | Anti SAR1B pAb (ATL-HPA048368) |