Anti SAP30BP pAb (ATL-HPA052943 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA052943-25

• 
• 
• 

Protein Description: SAP30 binding protein
Gene Name: SAP30BP
Alternative Gene Name: HCNGP, HTRG, HTRP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020755: 100%, ENSRNOG00000005482: 99%
Entrez Gene ID: 29115
Uniprot ID: Q9UHR5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QELVASFSERVRNMSPDEIKIPPEPPGRCSNHLQDKIQKLYERKIKEGMDMNYIIQRKKEFRNPSIYEKLIQFCAIDELGTNYP
• Gene Sequence: QELVASFSERVRNMSPDEIKIPPEPPGRCSNHLQDKIQKLYERKIKEGMDMNYIIQRKKEFRNPSIYEKLIQFCAIDELGTNYP
• Gene ID - Mouse: ENSMUSG00000020755
• Gene ID - Rat: ENSRNOG00000005482
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.