Anti SAP30BP pAb (ATL-HPA052943 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA052943-25
  • Immunohistochemical staining of human kidney shows strong nuclear / nuclear membranous positivity in cells in tubules along with strong nuclear positivity in cells in glomeruli.
  • Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm.
  • Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: SAP30 binding protein
Gene Name: SAP30BP
Alternative Gene Name: HCNGP, HTRG, HTRP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020755: 100%, ENSRNOG00000005482: 99%
Entrez Gene ID: 29115
Uniprot ID: Q9UHR5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QELVASFSERVRNMSPDEIKIPPEPPGRCSNHLQDKIQKLYERKIKEGMDMNYIIQRKKEFRNPSIYEKLIQFCAIDELGTNYP
Gene Sequence QELVASFSERVRNMSPDEIKIPPEPPGRCSNHLQDKIQKLYERKIKEGMDMNYIIQRKKEFRNPSIYEKLIQFCAIDELGTNYP
Gene ID - Mouse ENSMUSG00000020755
Gene ID - Rat ENSRNOG00000005482
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti SAP30BP pAb (ATL-HPA052943 w/enhanced validation)
Datasheet Anti SAP30BP pAb (ATL-HPA052943 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SAP30BP pAb (ATL-HPA052943 w/enhanced validation)