Anti SAMD14 pAb (ATL-HPA051916)

Atlas Antibodies

SKU: ATL-HPA051916-25

• 
• 

Protein Description: sterile alpha motif domain containing 14
Gene Name: SAMD14
Alternative Gene Name: FLJ36890
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047181: 94%, ENSRNOG00000004155: 97%
Entrez Gene ID: 201191
Uniprot ID: Q8IZD0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LDKKTRRKFLDLGVTLRRASTGKSRKEKGSNRLSMGSRESVEGSGRSGGSPFLPFSWFTDSGKGSASSGST
• Gene Sequence: LDKKTRRKFLDLGVTLRRASTGKSRKEKGSNRLSMGSRESVEGSGRSGGSPFLPFSWFTDSGKGSASSGST
• Gene ID - Mouse: ENSMUSG00000047181
• Gene ID - Rat: ENSRNOG00000004155
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.