Anti SAA4 pAb (ATL-HPA060139)

Atlas Antibodies

SKU:
ATL-HPA060139-25
  • Immunohistochemical staining of human kidney shows strong luminal membranous positivity in cells in tubules.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: serum amyloid A4, constitutive
Gene Name: SAA4
Alternative Gene Name: C-SAA, CSAA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074115: 59%, ENSRNOG00000055531: 59%
Entrez Gene ID: 6291
Uniprot ID: P35542
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FKEALQGVGDMGRAYWDIMISNHQNSNRYLYARGNYDAA
Gene Sequence FKEALQGVGDMGRAYWDIMISNHQNSNRYLYARGNYDAA
Gene ID - Mouse ENSMUSG00000074115
Gene ID - Rat ENSRNOG00000055531
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SAA4 pAb (ATL-HPA060139)
Datasheet Anti SAA4 pAb (ATL-HPA060139) Datasheet (External Link)
Vendor Page Anti SAA4 pAb (ATL-HPA060139) at Atlas Antibodies

Documents & Links for Anti SAA4 pAb (ATL-HPA060139)
Datasheet Anti SAA4 pAb (ATL-HPA060139) Datasheet (External Link)
Vendor Page Anti SAA4 pAb (ATL-HPA060139)