Anti S100G pAb (ATL-HPA055873 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA055873-25

• 

Protein Description: S100 calcium binding protein G
Gene Name: S100G
Alternative Gene Name: CABP1, CABP9K, CALB3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040808: 80%, ENSRNOG00000004222: 80%
Entrez Gene ID: 795
Uniprot ID: P29377
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KSPEELKRIFEKYAAKEGDPDQLSKDELKLLIQAEFPSLLKGPNTLDDLFQELDK
• Gene Sequence: KSPEELKRIFEKYAAKEGDPDQLSKDELKLLIQAEFPSLLKGPNTLDDLFQELDK
• Gene ID - Mouse: ENSMUSG00000040808
• Gene ID - Rat: ENSRNOG00000004222
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.