Anti S100A16 pAb (ATL-HPA045841 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA045841-25
  • Immunohistochemistry analysis in human esophagus and pancreas tissues using HPA045841 antibody. Corresponding S100A16 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
  • Western blot analysis in SK-BR-3 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-S100A16 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: S100 calcium binding protein A16
Gene Name: S100A16
Alternative Gene Name: DT1P1A7, MGC17528, S100F
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074457: 85%, ENSRNOG00000012053: 86%
Entrez Gene ID: 140576
Uniprot ID: Q96FQ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANHDGRISFDEYWTLIGGITGPIAKLIHEQEQ
Gene Sequence VIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANHDGRISFDEYWTLIGGITGPIAKLIHEQEQ
Gene ID - Mouse ENSMUSG00000074457
Gene ID - Rat ENSRNOG00000012053
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti S100A16 pAb (ATL-HPA045841 w/enhanced validation)
Datasheet Anti S100A16 pAb (ATL-HPA045841 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti S100A16 pAb (ATL-HPA045841 w/enhanced validation)