Protein Description: receptor-like tyrosine kinase
Gene Name: RYK
Alternative Gene Name: D3S3195, JTK5, JTK5A, RYK1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032547: 100%, ENSRNOG00000008593: 100%
Entrez Gene ID: 6259
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RYK
Alternative Gene Name: D3S3195, JTK5, JTK5A, RYK1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032547: 100%, ENSRNOG00000008593: 100%
Entrez Gene ID: 6259
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | LWELMTLGQTPYVDIDPFEMAAYLKDGYRIAQPINCPDELFAVMACCWALDPEERPKFQQLVQCLTEFHAALG |
Gene ID - Mouse | ENSMUSG00000032547 |
Gene ID - Rat | ENSMUSG00000032547 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RYK pAb (ATL-HPA075430) | |
Datasheet | Anti RYK pAb (ATL-HPA075430) Datasheet (External Link) |
Vendor Page | Anti RYK pAb (ATL-HPA075430) at Atlas |
Documents & Links for Anti RYK pAb (ATL-HPA075430) | |
Datasheet | Anti RYK pAb (ATL-HPA075430) Datasheet (External Link) |
Vendor Page | Anti RYK pAb (ATL-HPA075430) |