Anti RUNDC3B pAb (ATL-HPA075760)

Atlas Antibodies

SKU: ATL-HPA075760-25

• 

Product Description

Protein Description: RUN domain containing 3B
Gene Name: RUNDC3B
Alternative Gene Name: RPIB9, RPIP9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040570: 99%, ENSRNOG00000008463: 100%
Entrez Gene ID: 154661
Uniprot ID: Q96NL0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NQLSESVSQNKILLQRIEDSDLAHKLEKEQLEYIIVELQDQLTVLKNNDLRSRQELTAHLTNQWPSPGALDVNAVALDTLLYRKHNKQW
• Gene Sequence: NQLSESVSQNKILLQRIEDSDLAHKLEKEQLEYIIVELQDQLTVLKNNDLRSRQELTAHLTNQWPSPGALDVNAVALDTLLYRKHNKQW
• Gene ID - Mouse: ENSMUSG00000040570
• Gene ID - Rat: ENSRNOG00000008463
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links