Protein Description: RUN domain containing 3B
Gene Name: RUNDC3B
Alternative Gene Name: RPIB9, RPIP9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040570: 99%, ENSRNOG00000008463: 100%
Entrez Gene ID: 154661
Uniprot ID: Q96NL0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RUNDC3B
Alternative Gene Name: RPIB9, RPIP9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040570: 99%, ENSRNOG00000008463: 100%
Entrez Gene ID: 154661
Uniprot ID: Q96NL0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | NQLSESVSQNKILLQRIEDSDLAHKLEKEQLEYIIVELQDQLTVLKNNDLRSRQELTAHLTNQWPSPGALDVNAVALDTLLYRKHNKQW |
| Documents & Links for Anti RUNDC3B pAb (ATL-HPA075760) | |
| Datasheet | Anti RUNDC3B pAb (ATL-HPA075760) Datasheet (External Link) |
| Vendor Page | Anti RUNDC3B pAb (ATL-HPA075760) at Atlas |
| Documents & Links for Anti RUNDC3B pAb (ATL-HPA075760) | |
| Datasheet | Anti RUNDC3B pAb (ATL-HPA075760) Datasheet (External Link) |
| Vendor Page | Anti RUNDC3B pAb (ATL-HPA075760) |