Anti RUFY1 pAb (ATL-HPA057614)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057614-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: RUFY1
Alternative Gene Name: FLJ22251, RABIP4, ZFYVE12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020375: 85%, ENSRNOG00000003536: 84%
Entrez Gene ID: 80230
Uniprot ID: Q96T51
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NLQMFHKAQNAESSLQQKNEAITSFEGKTNQVMSSMKQMEERLQHSERARQGAEERSHKLQQELGGRIGALQLQLSQLHEQCSSLEKEL |
Gene Sequence | NLQMFHKAQNAESSLQQKNEAITSFEGKTNQVMSSMKQMEERLQHSERARQGAEERSHKLQQELGGRIGALQLQLSQLHEQCSSLEKEL |
Gene ID - Mouse | ENSMUSG00000020375 |
Gene ID - Rat | ENSRNOG00000003536 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RUFY1 pAb (ATL-HPA057614) | |
Datasheet | Anti RUFY1 pAb (ATL-HPA057614) Datasheet (External Link) |
Vendor Page | Anti RUFY1 pAb (ATL-HPA057614) at Atlas Antibodies |
Documents & Links for Anti RUFY1 pAb (ATL-HPA057614) | |
Datasheet | Anti RUFY1 pAb (ATL-HPA057614) Datasheet (External Link) |
Vendor Page | Anti RUFY1 pAb (ATL-HPA057614) |