Anti RUBCN pAb (ATL-HPA054497)

Atlas Antibodies

SKU:
ATL-HPA054497-25
  • Immunohistochemical staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: RUN domain and cysteine-rich domain containing, Beclin 1-interacting protein
Gene Name: RUBCN
Alternative Gene Name: KIAA0226, rubicon, rundataxin
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035629: 64%, ENSRNOG00000059880: 64%
Entrez Gene ID: 9711
Uniprot ID: Q92622
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RSHSDTSIASRGAPESCNDKAKLRGPLPYSGQSSEVSTPSSLYMEYEGGRYLCSGEGMFRRPSEGQSLISYLSEQDFGSCADLEKENAHFS
Gene Sequence RSHSDTSIASRGAPESCNDKAKLRGPLPYSGQSSEVSTPSSLYMEYEGGRYLCSGEGMFRRPSEGQSLISYLSEQDFGSCADLEKENAHFS
Gene ID - Mouse ENSMUSG00000035629
Gene ID - Rat ENSRNOG00000059880
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti RUBCN pAb (ATL-HPA054497)
Datasheet Anti RUBCN pAb (ATL-HPA054497) Datasheet (External Link)
Vendor Page Anti RUBCN pAb (ATL-HPA054497) at Atlas Antibodies

Documents & Links for Anti RUBCN pAb (ATL-HPA054497)
Datasheet Anti RUBCN pAb (ATL-HPA054497) Datasheet (External Link)
Vendor Page Anti RUBCN pAb (ATL-HPA054497)