Anti RTFDC1 pAb (ATL-HPA053986)

Atlas Antibodies

SKU:
ATL-HPA053986-100
  • Immunohistochemical staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.
  • Immunofluorescent staining of human cell line HeLa shows localization to nucleus & nucleoli.
  • Western blot analysis in human cell line SK-BR-3.
Shipping:
Calculated at Checkout
$554.00
Adding to cart… The item has been added
Protein Description: replication termination factor 2 domain containing 1
Gene Name: RTFDC1
Alternative Gene Name: C20orf43, CDAO5, HSPC164
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027502: 95%, ENSRNOG00000005083: 95%
Entrez Gene ID: 51507
Uniprot ID: Q9BY42
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AWEGDKGNTKGDKHDDLQRARFICPVVGLEMNGRHRFCFLRCCGCVFSERALKEIKAEVCHTCGAAFQEDDVIVLNGTKEDVDVLK
Gene Sequence AWEGDKGNTKGDKHDDLQRARFICPVVGLEMNGRHRFCFLRCCGCVFSERALKEIKAEVCHTCGAAFQEDDVIVLNGTKEDVDVLK
Gene ID - Mouse ENSMUSG00000027502
Gene ID - Rat ENSRNOG00000005083
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti RTFDC1 pAb (ATL-HPA053986)
Datasheet Anti RTFDC1 pAb (ATL-HPA053986) Datasheet (External Link)
Vendor Page Anti RTFDC1 pAb (ATL-HPA053986) at Atlas Antibodies

Documents & Links for Anti RTFDC1 pAb (ATL-HPA053986)
Datasheet Anti RTFDC1 pAb (ATL-HPA053986) Datasheet (External Link)
Vendor Page Anti RTFDC1 pAb (ATL-HPA053986)