Anti RSPH6A pAb (ATL-HPA045382 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA045382-25

• 

Protein Description: radial spoke head 6 homolog A (Chlamydomonas)
Gene Name: RSPH6A
Alternative Gene Name: RSHL1, RSP4, RSP6, RSPH4B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040866: 46%, ENSRNOG00000061526: 48%
Entrez Gene ID: 81492
Uniprot ID: Q9H0K4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LTTSLMLQRLQQGQSSLFQQLDPTFQEPPVNPLGQFNLYQTDQFSEGAQHGPYIRDDPALQFLPSELGFPHYSAQVP
• Gene Sequence: LTTSLMLQRLQQGQSSLFQQLDPTFQEPPVNPLGQFNLYQTDQFSEGAQHGPYIRDDPALQFLPSELGFPHYSAQVP
• Gene ID - Mouse: ENSMUSG00000040866
• Gene ID - Rat: ENSRNOG00000061526
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RSPH6A pAb (ATL-HPA045382 w/enhanced validation) – 1 Found

Minucci, Sergio; Venditti, Massimo. New Insight on the In Vitro Effects of Melatonin in Preserving Human Sperm Quality. International Journal Of Molecular Sciences. 2022;23(9)