Anti RSL24D1 pAb (ATL-HPA062724 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA062724-25
  • Immunohistochemical staining of human colon, kidney, liver and testis using Anti-RSL24D1 antibody HPA062724 (A) shows similar protein distribution across tissues to independent antibody HPA063392 (B).
  • Immunofluorescent staining of human cell line SK-MEL-30 shows localization to nucleus & nucleoli.
  • Western blot analysis using Anti-RSL24D1 antibody HPA062724 (A) shows similar pattern to independent antibody HPA063392 (B).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ribosomal L24 domain containing 1
Gene Name: RSL24D1
Alternative Gene Name: C15orf15, HRP-L30-iso, L30, RPL24, RPL24L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032215: 100%, ENSRNOG00000052787: 98%
Entrez Gene ID: 51187
Uniprot ID: Q9UHA3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QRELWNKTIDAMKRVEEIKQKRQAKFIMNRLKKNKELQKVQDIKEVKQNIH
Gene Sequence QRELWNKTIDAMKRVEEIKQKRQAKFIMNRLKKNKELQKVQDIKEVKQNIH
Gene ID - Mouse ENSMUSG00000032215
Gene ID - Rat ENSRNOG00000052787
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti RSL24D1 pAb (ATL-HPA062724 w/enhanced validation)
Datasheet Anti RSL24D1 pAb (ATL-HPA062724 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti RSL24D1 pAb (ATL-HPA062724 w/enhanced validation)