Anti RSF1 pAb (ATL-HPA057547)

Atlas Antibodies

SKU:
ATL-HPA057547-25
  • Immunofluorescent staining of human cell line CACO-2 shows localization to nucleoplasm.
  • Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: remodeling and spacing factor 1
Gene Name: RSF1
Alternative Gene Name: HBXAP, p325, RSF-1, XAP8
Isotype: IgG
Interspecies mouse/rat: ,
Entrez Gene ID: 51773
Uniprot ID: Q96T23
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VDLETLKEDSEFTKVEMDNLDNAQTSGIEEPSETKGSMQKSKFKYKLVPEEETTASENTEITSERQKEGIKLTIRI
Gene Sequence VDLETLKEDSEFTKVEMDNLDNAQTSGIEEPSETKGSMQKSKFKYKLVPEEETTASENTEITSERQKEGIKLTIRI
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti RSF1 pAb (ATL-HPA057547)
Datasheet Anti RSF1 pAb (ATL-HPA057547) Datasheet (External Link)
Vendor Page Anti RSF1 pAb (ATL-HPA057547) at Atlas Antibodies

Documents & Links for Anti RSF1 pAb (ATL-HPA057547)
Datasheet Anti RSF1 pAb (ATL-HPA057547) Datasheet (External Link)
Vendor Page Anti RSF1 pAb (ATL-HPA057547)