Anti RSF1 pAb (ATL-HPA046129)

Atlas Antibodies

SKU: ATL-HPA046129-25

• 

Protein Description: remodeling and spacing factor 1
Gene Name: RSF1
Alternative Gene Name: HBXAP, p325, RSF-1, XAP8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035623: 100%, ENSRNOG00000024194: 99%
Entrez Gene ID: 51773
Uniprot ID: Q96T23
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KYLCECQFDDNLKFKNIINEEDADTMRLQPIGRDKDGLMYWYQLDQDHNVRMYIEEQDDQDGSSWKCIVRNRNELAETLALLKAQIDPVLLK
• Gene Sequence: KYLCECQFDDNLKFKNIINEEDADTMRLQPIGRDKDGLMYWYQLDQDHNVRMYIEEQDDQDGSSWKCIVRNRNELAETLALLKAQIDPVLLK
• Gene ID - Mouse: ENSMUSG00000035623
• Gene ID - Rat: ENSRNOG00000024194
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RSF1 pAb (ATL-HPA046129) – 1 Found

He, Jiani; Fu, Lin; Li, Qingchang. Rsf‑1 regulates malignant melanoma cell viability and chemoresistance via NF‑κB/Bcl‑2 signaling. Molecular Medicine Reports. 2019;20(4):3487-3498.